PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 192aa    MW: 20999.9 Da    PI: 4.6729
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42381371100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lpe +r da++s+vyeA+ar+rdPvyG++g i +lq q+++l+aela
  XP_011077047.1  38 PCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQELPEAQRADAVNSMVYEANARLRDPVYGCAGAICQLQYQISELQAELA 132
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011077047.1 133 KAQAE 137
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.64437138IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4238135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MEYSENTTAI ATAEPSPSAV SPTSSSSPPS SPPVILSPCA ACKILRRRCA EKCVLAPYFP  60
PTEPLKFTIA HRVFGASNII KLLQELPEAQ RADAVNSMVY EANARLRDPV YGCAGAICQL  120
QYQISELQAE LAKAQAEILN MQCQNANLFE LIGKQVAAET DRQPQTLPSV HENTTFFFDE  180
SILGVAWEPL WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077047.11e-140PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RH949e-90A0A022RH94_ERYGU; Uncharacterized protein
STRINGSolyc05g048740.2.11e-81(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-62LOB domain-containing protein 1